PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G260300.2.p
Common NameSb03g031430, SORBIDRAFT_03g031430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 334aa    MW: 35666 Da    PI: 8.1646
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G260300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-181462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          rg+W++eEdell  +v+ +G+g +W + +++ g++R++k+c++rw++yl
  Sobic.003G260300.2.p 14 RGPWSPEEDELLRSYVHNHGTGgNWIALPHKAGLNRCGKSCRLRWLNYL 62
                          89*********************************************97 PP

2Myb_DNA-binding377.7e-1271111446
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            T++Ed ++  + +  G++ W+ Ia++++ gRt++++k++w++
  Sobic.003G260300.2.p  71 YTEQEDRIICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                           69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.218966IPR017930Myb domain
SuperFamilySSF466891.5E-2711109IPR009057Homeodomain-like
SMARTSM007171.0E-121364IPR001005SANT/Myb domain
PfamPF002496.3E-171462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-241569IPR009057Homeodomain-like
CDDcd001671.15E-91662No hitNo description
PROSITE profilePS5129414.5767117IPR017930Myb domain
SMARTSM007171.3E-1167115IPR001005SANT/Myb domain
PfamPF002491.4E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-2270116IPR009057Homeodomain-like
CDDcd001671.36E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRAPCCDKT SVKRGPWSPE EDELLRSYVH NHGTGGNWIA LPHKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG YTEQEDRIIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAIAN  120
MQQQQEEYYH HHQQHSSGGG RGRRGGAAAA VTPRAAPRSQ QCASSMQPSP ASASSAVTTA  180
SASDACSFGA MYPSPSTTTL QAAAPVLARY DGTAPAPPLP PPPPQQQQQQ QASALAEFSP  240
APAPATAISG TWAAGLPLDD MFLPELLGDS EFPPGGDFFG TGFAPLLLQD RAASASLQEL  300
SACYFPNAQA EMWAAADHHV HVKPPAGLCH SLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794310.0HF679431.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB25 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456161.10.0hypothetical protein SORBIDRAFT_03g031430
TrEMBLC5XGT20.0C5XGT2_SORBI; Putative uncharacterized protein Sb03g031430
STRINGSb03g031430.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-69myb domain protein 84